PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G04230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 401aa    MW: 43115.4 Da    PI: 10.9161
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G04230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA46.74.2e-15141173133
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                      C nC + +Tp+WR+gp g++tLCnaCG++ r  
  OPUNC12G04230.1 141 CLNCDAVETPQWRSGPMGKSTLCNACGVRLRAV 173
                      99**************************99865 PP

2GATA56.24.7e-18269303135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++Cg+t+Tp+WR+gp g  tLCnaCG++yr  +l
  OPUNC12G04230.1 269 CVHCGSTETPQWREGPMGRGTLCNACGVRYRQGRL 303
                      *******************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR012173.0E-96981No hitNo description
PRINTSPR012173.0E-988104No hitNo description
SMARTSM004011.1E-13135189IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.097135174IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.81E-12135176No hitNo description
Gene3DG3DSA:3.30.50.103.0E-13139174IPR013088Zinc finger, NHR/GATA-type
PfamPF003202.0E-12141172IPR000679Zinc finger, GATA-type
PROSITE patternPS003440141166IPR000679Zinc finger, GATA-type
CDDcd002021.31E-11141183No hitNo description
PRINTSPR012173.0E-9195211No hitNo description
PRINTSPR012173.0E-9213230No hitNo description
PRINTSPR012173.0E-9231256No hitNo description
SMARTSM004011.7E-16263313IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.44263299IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-15265325No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14267301IPR013088Zinc finger, NHR/GATA-type
PfamPF003208.0E-16269303IPR000679Zinc finger, GATA-type
PROSITE patternPS003440269294IPR000679Zinc finger, GATA-type
CDDcd002023.31E-15269325No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MAAVEGGIRE PPGLARQRRP RLRRSVAATG DMDGDGHGGG GGSRYVLALP AMASLAVLIA  60
HLDAAVPRRP RSYLPRAVPM GWWAFRLPVF SRPPPSPPSP AKNRVKEEEE EEEARVLVVA  120
PPPVDPGEEA RKRAAKRARR CLNCDAVETP QWRSGPMGKS TLCNACGVRL RAVGSLPEHR  180
PAARTTPTEP PPTAPASPPD SPIWTPGHKP SSSPDIYLVR RTPKLPVTRP PRSKQPPPTA  240
PAPVSPPPPP APKTKTKTKA KKQKRKRSCV HCGSTETPQW REGPMGRGTL CNACGVRYRQ  300
GRLLPEYRPK GSPTFSPSVH AANHRQVLEL RRQQRHNTNS AATTAAKPIP DEQKPVYLPA  360
QEEVVNAPVA ATGGAASSLD ALLFDGPSAP LIVDGDDFLV S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620068.11e-153PREDICTED: vegetative cell wall protein gp1
TrEMBLA0A0E0MK480.0A0A0E0MK48_ORYPU; Uncharacterized protein
STRINGORGLA12G0039500.11e-155(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP72732646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45170.13e-29GATA transcription factor 14